PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 324aa    MW: 35387.4 Da    PI: 7.0382
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000020.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.31.3e-54121217197
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+ege+
  Pbr000020.1 121 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYREMEGER 217
                  69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.8E-52116229IPR009072Histone-fold
SuperFamilySSF471132.02E-38124221IPR009072Histone-fold
PfamPF008088.9E-26127191IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-16155173No hitNo description
PROSITE patternPS006850158174IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.4E-16174192No hitNo description
PRINTSPR006152.4E-16193211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSLLVAREEK TVYKWQPSYM QSVTPYRTSG LHACIYIYDH TSPGPTPLHS PSVRLRLLVS  60
ALLKLSDINL RQAEMNQYSM GMGRQTTATT NVNNVFNNNN VNHPSNANTT NGTADDNECM  120
VREQDRFMPI ANVIRIMRKI LPPHAKISDD AKETIQECVS EYISFITGEA NERCQREQRK  180
TITAEDVLWA MSKLGFDDYI EPLTLYLHRY REMEGERGSS TTSLMRSESL AKGAGASSGT  240
SSRSMDHPQY YGTSMAAAFH HQHGHGLFGY MQPSDVSVSN NNANAAAASG SSTQLQGGGS  300
AAMPNGDHHQ PHANGANGPS GGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-40122212393NF-YB
4awl_B9e-40122212494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-40122212494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368216.10.0PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotQ84W665e-70NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLM5WHY19e-78M5WHY1_PRUPE; Uncharacterized protein
STRINGVIT_00s0956g00020.t015e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-68nuclear factor Y, subunit B6